PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 288aa    MW: 32309.9 Da    PI: 4.833
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598015.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.21.3e-31124180258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     dDgy+WrKYGqK++k+s++prsYY+Ct ++C +kk+vers+++p++++itYeg H h
  XP_009598015.1 124 DDGYKWRKYGQKSIKNSPYPRSYYKCTNPRCGAKKQVERSSDEPDTFVITYEGLHLH 180
                     8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.187118183IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.9E-29118180IPR003657WRKY domain
SuperFamilySSF1182901.06E-26120180IPR003657WRKY domain
SMARTSM007741.6E-35123182IPR003657WRKY domain
PfamPF031061.3E-25124180IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MAMEELEELK NSWTYQDELI KELLDNESPF FLASQDSNST NCPSSTDNSL VTKSINISTV  60
SSGPNMDDIE SGLSVTSYGI QSHDVSHARS FGLERGLNLM MSKQEPHETK YSLRIKTCGN  120
AMADDGYKWR KYGQKSIKNS PYPRSYYKCT NPRCGAKKQV ERSSDEPDTF VITYEGLHLH  180
FAYPFLTLDP TQFLEQPNKK PKLTNSKAQN EEFENASEID ESPKYVNPSP VVVFEQELGF  240
GVMGSQGLLE DMVPLMVRNP SMKPTSSYSS SCSYSSPPTS PSFSWSNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-221221801674Probable WRKY transcription factor 4
2lex_A6e-221221801674Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598015.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLK4CRC21e-119K4CRC2_SOLLC; Uncharacterized protein
STRINGSolyc09g010960.2.11e-119(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120752124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.11e-47WRKY DNA-binding protein 49